PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10019025m
Common NameEUTSA_v10019025mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 259aa    MW: 30417.6 Da    PI: 8.5799
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10019025mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.17.6e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtfskRr+g+lKKA+E+SvLCdaeva+++fs++gkl+eys+
  Thhalv10019025m  9 KRIENKINRQVTFSKRRAGLLKKAHEISVLCDAEVALVVFSHKGKLFEYST 59
                     79***********************************************96 PP

2K-box108.29.3e-36791745100
            K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +  + e+  + +++ e+++Lk++ie L+r+qRh+lGedL+ +s keLq+LeqqL+++lk+iRs+Kn+l++++i+elq+kek++qe+n +L+k++
  Thhalv10019025m  79 QLIAPESDVNTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSPKELQNLEQQLDTALKHIRSRKNQLMYDSINELQRKEKAIQEQNSMLSKQI 172
                      555556666889*********************************************************************************9 PP

            K-box  99 ee 100
                      +e
  Thhalv10019025m 173 KE 174
                      87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.184161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.41E-34289IPR002100Transcription factor, MADS-box
CDDcd002651.82E-42279No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-31323IPR002100Transcription factor, MADS-box
PfamPF003199.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.7E-3085172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.00788178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009933Biological Processmeristem structural organization
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRGRVQLKR IENKINRQVT FSKRRAGLLK KAHEISVLCD AEVALVVFSH KGKLFEYSTD  60
SCMEKILERY ERYSYAERQL IAPESDVNTN WSMEYNRLKA KIELLERNQR HYLGEDLQAM  120
SPKELQNLEQ QLDTALKHIR SRKNQLMYDS INELQRKEKA IQEQNSMLSK QIKEREKILR  180
AQQEQWDQQN HGHNMPPPPP PQQQQHQIQH PYMLSHQPSP FLNMGGLYQE EDPMAMRRND  240
LDLSLEPVYN CNLGCFAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q4e-21174173Myocyte-specific enhancer factor 2B
1tqe_R4e-21174173Myocyte-specific enhancer factor 2B
1tqe_S4e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00096ChIP-seqTransfer from AT1G69120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0879560.0AY087956.1 Arabidopsis thaliana clone 39890 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391056.10.0hypothetical protein EUTSA_v10019025mg
SwissprotP0DI140.0AP1_BRARP; Floral homeotic protein APETALA 1
TrEMBLV4KEU30.0V4KEU3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.2__1169__AT1G69120.11e-172(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79225110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-162MIKC_MADS family protein